PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 415aa    MW: 45402.7 Da    PI: 4.719
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454553.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.3e-1498142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W++I+r+    Rt+ q+ s+ qk+
   XP_016454553.1  98 AWTAEEHRLFLQGLEKYGRGDWRSISRHCVVSRTPTQVASHAQKF 142
                      7*****************************9************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.443761IPR017884SANT domain
SMARTSM007170.0043859IPR001005SANT/Myb domain
SuperFamilySSF466891.44E-81164IPR009057Homeodomain-like
CDDcd001671.34E-41157No hitNo description
PROSITE profilePS5129418.97991147IPR017930Myb domain
SuperFamilySSF466891.58E-1693148IPR009057Homeodomain-like
SMARTSM007172.2E-1195145IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.8E-1695145IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.7E-1196138IPR009057Homeodomain-like
CDDcd001674.61E-1198143No hitNo description
PfamPF002494.3E-1198141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MNPDQTCNSS SWTKEEDRAF ETALAIYAGD SDQLMKIAAA VPRKSIPEIL QHYKKLVDDI  60
NDIEAGKVPL PRYGRMQGCS SRRSRLSGAE VERRKGVAWT AEEHRLFLQG LEKYGRGDWR  120
SISRHCVVSR TPTQVASHAQ KFFSRLKDNN KAKRRRSIHD ITTVDTVTTE PSQGQETEKL  180
NGPCGGQLQW PITDYVTEAF DIGMFPLPRP VTNCMTDAIG GPSSVNPETF PFGTAVVSEL  240
NSSLPNMDDE FLLGVEDLIT VPTQGTSEAW RGVDTRSSTS LSWQPSFVDG TGLYTYPVNS  300
VGYEMEELIT KELVEATQVG PIVNTARLPL SIADHIGVHG CTTSSSGAKN GFESTVGALE  360
AGLSVDSNPL LSIPGTSGSG EYPSFNASIM DNNIFDLEDL FPDQMIGFYE KDGKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454553.10.0PREDICTED: uncharacterized protein LOC107778765 isoform X2
TrEMBLA0A0V0J0A01e-139A0A0V0J0A0_SOLCH; Putative ovule protein
TrEMBLM1BM041e-137M1BM04_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000481331e-136(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-48MYB family protein